PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn284591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family GRAS
Protein Properties Length: 580aa    MW: 64982.1 Da    PI: 4.8191
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn284591genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.47.8e-1362105792374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL++cA ++s+g+ + a+++++ l++++s +gdp++R+aay++eALaar+a s++ lykal+++e +   s ++l+a+++++ev+P+++f++++aN 
  Achn284591 210 KQLLYDCAVMISEGNITDASTVINDLRQRVSIQGDPTERIAAYMVEALAARVAASGKCLYKALKCKEPP---SNDRLSAMQVLFEVCPCFRFGFMAANG 305
                 589*****************************************************************9...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 aI ea + e+r+HiiDfdi+qG Q+++L+q+La++p++pp+lR+Tgv++pes+  s   l+ +g+rL+++Ae+l+v+fef++ va +++++++++L+++
  Achn284591 306 AIIEASKDESRIHIIDFDINQGSQYITLIQTLAKQPGKPPQLRLTGVDDPESVqrSVGGLKVIGQRLEELAEQLKVQFEFHA-VAANTAEVNPSMLNCR 403
                 ***************************************************9988999************************.7999************ PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                  gEal+Vn+++qlh+++desvs+ ++rd++L++vkslsPk+v+vveq++++n+++Fl rf+ea +yysa++dsl+a+lpr+s++r +vE+++l+r+ivn
  Achn284591 404 AGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLSPKLVTVVEQDVNTNTAPFLPRFAEAYNYYSAVYDSLDATLPRDSQDRLNVEKHCLARDIVN 502
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +vaceg+er+er e ++kWr+r+++aGFkp p+s+++++ +  l++++ ++ y+v++esg++ + W+d+ L++ SaWr
  Achn284591 503 IVACEGEERIERYEVAGKWRARMMMAGFKPCPISSNVNEAILKLIKQYCDR-YKVKDESGAIHFAWEDKVLIVSSAWR 579
                 ************************************************966.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.39183560IPR005202Transcription factor GRAS
PfamPF035142.7E-133210579IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MSLVRSQDQY ARSYGNPKLY ALNGNDSPGI STPIFNSEKH NKIMYATDSC SSESYDPKYF  60
LNSPTEEFVH SSSYSNSENR FRPEVQSTSM TALNPFNSFV AMRHQDPYQA NFESEYLESQ  120
SPDALDYGEG EMRLKLRELE RALLDDNDVD EDDDAFGPHQ SMEIDGEWTH PICNPLQHES  180
PKESSSLDSI LSCSSSTKEI SLTSSPRTPK QLLYDCAVMI SEGNITDAST VINDLRQRVS  240
IQGDPTERIA AYMVEALAAR VAASGKCLYK ALKCKEPPSN DRLSAMQVLF EVCPCFRFGF  300
MAANGAIIEA SKDESRIHII DFDINQGSQY ITLIQTLAKQ PGKPPQLRLT GVDDPESVQR  360
SVGGLKVIGQ RLEELAEQLK VQFEFHAVAA NTAEVNPSML NCRAGEALIV NFAFQLHHMP  420
DESVSTVNQR DQLLRMVKSL SPKLVTVVEQ DVNTNTAPFL PRFAEAYNYY SAVYDSLDAT  480
LPRDSQDRLN VEKHCLARDI VNIVACEGEE RIERYEVAGK WRARMMMAGF KPCPISSNVN  540
EAILKLIKQY CDRYKVKDES GAIHFAWEDK VLIVSSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-6122857922375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015868691.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015868690.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015868689.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015868688.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLW9RNG00.0W9RNG0_9R
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1